PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012568385.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 219aa    MW: 24931.7 Da    PI: 9.5485
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012568385.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.41.9e-28958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    k+i+n + rqvtfskRr gi+KKAeELSvLCdaev +iifs tgklyey 
  XP_012568385.1  9 KKIDNATARQVTFSKRRRGIFKKAEELSVLCDAEVGLIIFSATGKLYEYG 58
                    68***********************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.123161IPR002100Transcription factor, MADS-box
CDDcd002651.06E-39272No hitNo description
SuperFamilySSF554555.23E-32375IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-27323IPR002100Transcription factor, MADS-box
PfamPF003194.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.7285175IPR002487Transcription factor, K-box
PfamPF014861.3E-1392169IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MARQKIKIKK IDNATARQVT FSKRRRGIFK KAEELSVLCD AEVGLIIFSA TGKLYEYGSS  60
NMKDIITRYN QHFQHMSKSN KPLQEFQGEN LSAELQKEVA DKTQQLRGMK GEDFEGINLK  120
GLQELEKTLE TGLKRVMEMK EKRIVNEIST LQIKGIKLEE QNKHLKQKMA MLCNRKNLIL  180
GDSDITMQEI VSSESMNNSG LSLEDDSSDT SLKLGLPYP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S6e-20185186Myocyte-specific enhancer factor 2B
1tqe_R6e-20185186Myocyte-specific enhancer factor 2B
1tqe_Q6e-20185186Myocyte-specific enhancer factor 2B
1tqe_P6e-20185186Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012568385.11e-159PREDICTED: MADS-box protein SVP-like isoform X2
RefseqXP_004490446.11e-159PREDICTED: MADS-box protein SVP-like isoform X2
SwissprotQ9FVC12e-71SVP_ARATH; MADS-box protein SVP
TrEMBLG7KBL21e-118G7KBL2_MEDTR; MADS-box transcription factor
STRINGGLYMA06G10020.23e-80(Glycine max)
STRINGVIT_18s0001g07460.t013e-79(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.14e-65MIKC_MADS family protein